PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012173-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 343aa    MW: 39134.1 Da    PI: 4.812
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012173-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ede l d++k +G g W+  +++ g++R++k+c++rw++yl
    NNU_012173-RA 14 KGAWSAQEDEVLMDYIKFHGEGKWRGLPSKAGLKRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.39.5e-1572110646
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +E+el+++++++lG++ W++Ia +++ gRt++++k++w++
    NNU_012173-RA  72 HDEEELIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                      69***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.176961IPR017930Myb domain
SuperFamilySSF466894.3E-2712108IPR009057Homeodomain-like
SMARTSM007175.6E-111363IPR001005SANT/Myb domain
PfamPF002498.2E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-211568IPR009057Homeodomain-like
CDDcd001673.80E-81661No hitNo description
PROSITE profilePS5129423.93962116IPR017930Myb domain
SMARTSM007177.8E-1366114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2269116IPR009057Homeodomain-like
PfamPF002494.8E-1372110IPR001005SANT/Myb domain
CDDcd001677.37E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRRPCCSKD GLNKGAWSAQ EDEVLMDYIK FHGEGKWRGL PSKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI AHDEEELIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT KLVKKVQDHP  120
KTITSSTHRH SNLSKDDDDD NEKKKKPIEP SPTPNTESRV VRPKAVRCTK VFLSPPCNNQ  180
LVEPFATSTA MDLESNDWLS SFIPEEDKVF LSPPCNNQLV EPFATSTAMD LESNDWLSSF  240
IPEEDKVFLS PPCNNQLVEP FATSTAMDLE SNDWLSSFIP EEDNSLDFMM DLNVDDFGLS  300
YLLNSDFFQL CRYYNGLVGE ISCCNDITPS SDQPLFYPDE LLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264424.10.0PREDICTED: transcription factor TT2-like
TrEMBLA0A0J8B8964e-80A0A0J8B896_BETVU; Uncharacterized protein
TrEMBLM5WG391e-79M5WG39_PRUPE; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.17e-54myb domain protein 7